• Gene id: 55839

Gene Summary

• Gene Symbol: CENPN   Gene   UCSC   Ensembl
• Aliases: BM039, C16orf60, CENP-N, ICEN32
• Gene name: centromere protein N
• Alternate names: centromere protein N, interphase centromere complex protein 32,
• Gene location: 16q23.2 (81006497: 81033106)     Exons: 13     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene forms part of the nucleosome-associated complex and is important for kinetochore assembly. It is bound to kinetochores during S phase and G2 and recruits other proteins to the centromere. Pseudogenes of this gene are locat
• OMIM: 611509

Protein Summary

• Protein general information: Q96H22  
  • Name: Centromere protein N (CENP N) (Interphase centromere complex protein 32)
  • Length: 339  
  • Mass: 39555
• Sequence:

  MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQ
  FHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPT
  YVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTFETHNSTTPLQER
  SLGLDINMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREEPLRCLIKFSSP
  HLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK

• Structural information:
  • Interpro: IPR007902  
  • PDB: 6BUZ 6C0W 6EQT 6MUO 6MUP
  • PDBsum: 6BUZ 6C0W 6EQT 6MUO 6MUP
  • STRING: ENSP00000377007
• Other Databases: GeneCards:  CENPN  Malacards:  CENPN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007059	chromosome segregation	IEA	biological process
GO:0051382	kinetochore assembly	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray