• Gene id: 55831

Gene Summary

• Gene Symbol: EMC3   Gene   UCSC   Ensembl
• Aliases: POB, TMEM111
• Gene name: ER membrane protein complex subunit 3
• Alternate names: ER membrane protein complex subunit 3, 30 kDa protein, partial optokinetic response b, transmembrane protein 111,
• Gene location: 3p25.3 (138460258: 138589995)     Exons: 20     NC_000007.14

Protein Summary

• Protein general information: Q9P0I2  
  • Name: ER membrane protein complex subunit 3 (Transmembrane protein 111)
  • Length: 261  
  • Mass: 29952
• Sequence:

  MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPKQSFLT
  RKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTLRFKP
  MLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEAL
  ELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

• Structural information:
  • Interpro: IPR008568  IPR002809  
  • STRING: ENSP00000245046
• Other Databases: GeneCards:  EMC3  Malacards:  EMC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072546	ER membrane protein complex	IBA	cellular component
GO:0072546	ER membrane protein complex	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray