• Gene id: 55821

Gene Summary

• Gene Symbol: ALLC   Gene   UCSC   Ensembl
• Aliases: ALC
• Gene name: allantoicase
• Alternate names: probable allantoicase, allantoate amidinohydrolase,
• Gene location: 2p25.3 (3645367: 3702670)     Exons: 5     NC_000002.12
• Gene summary(Entrez): Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.[supplied by OMIM, Nov 2008]
• OMIM: 612396

Protein Summary

• Protein general information: Q8N6M5  
  • Name: Probable allantoicase (EC 3.5.3.4) (Allantoate amidinohydrolase)
  • Length: 391  
  • Mass: 43559
• Sequence:

  MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQGVIRGF
  DVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGH
  NYFLVNSQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVG
  GAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
  EEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSRLRLRGFPSSICLLRP
  REKPMLKFSVSFKANP

• Structural information:
  • Interpro: IPR005164  IPR015908  IPR008979  
  • STRING: ENSP00000252505
• Other Databases: GeneCards:  ALLC  Malacards:  ALLC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000256	allantoin catabolic process	IBA	biological process
GO:0004037	allantoicase activity	IBA	molecular function
GO:0000256	allantoin catabolic process	IEA	biological process
GO:0004037	allantoicase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004037	allantoicase activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R