• Gene id: 55795

Gene Summary

• Gene Symbol: PCID2   Gene   UCSC   Ensembl
• Aliases: F10
• Gene name: PCI domain containing 2
• Alternate names: PCI domain-containing protein 2, CSN12-like protein,
• Gene location: 13q34 (113209466: 113165001)     Exons: 23     NC_000013.11
• Gene summary(Entrez): This gene encodes a component of the TREX-2 complex (transcription and export complex 2), which regulates mRNA export from the nucleus. This protein regulates expression of Mad2 mitotic arrest deficient-like 1, a cell division checkpoint protein. This pro
• OMIM: 613713

Protein Summary

• Protein general information: Q5JVF3  
  • Name: PCI domain containing protein 2 (CSN12 like protein)
  • Length: 399  
  • Mass: 46030
• Sequence:

  MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYAVGNH
  DFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFR
  VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSD
  FKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAK
  HEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKG
  YISHQHQKLVVSKQNPFPPLSTVC

• Structural information:
  • Protein Domains: (210..39-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR000717  IPR036388  
  • Prosite: PS50250
  • PDB: 3T5X
  • PDBsum: 3T5X
  • DIP: 50497
• Other Databases: GeneCards:  PCID2  Malacards:  PCID2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0016973	poly(A)+ mRNA export from nucleus	IBA	biological process
GO:0000973	posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0006368	transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0070390	transcription export complex 2	IBA	cellular component
GO:0071033	nuclear retention of pre-mRNA at the site of transcription	IBA	biological process
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0070390	transcription export complex 2	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:2000117	negative regulation of cysteine-type endopeptidase activity	IMP	biological process
GO:0048536	spleen development	ISS	biological process
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray