• Gene id: 55789

Gene Summary

• Gene Symbol: DEPDC1B   Gene   UCSC   Ensembl
• Aliases: BRCC3, XTP1
• Gene name: DEP domain containing 1B
• Alternate names: DEP domain-containing protein 1B, HBV X-transactivated gene 8 protein, HBV XAg-transactivated protein 8, HBxAg transactivated protein 1, breast cancer cell 3,
• Gene location: 5q12.1 (60700165: 60596911)     Exons: 15     NC_000005.10
• OMIM: 616073

Protein Summary

• Protein general information: Q8WUY9  
  • Name: DEP domain containing protein 1B (HBV X transactivated gene 8 protein) (HBV XAg transactivated protein 8)
  • Length: 529  
  • Mass: 61771
• Sequence:

  MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCSQNFGPEVTRKQTVQL
  LKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKDVIKFPEWNDLPPGTSQENIPVRPVVM
  NSEMWYKRHSIAIGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVS
  KQGVVILDDKSKELPHWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYGHLKEPLLTFHLFDAFVSVLG
  LLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDE
  LLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGADMDITLSAPSFCRQISPEEFEYQRSYGSQE
  PLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTR
  SFRM

• Structural information:
  • Protein Domains: (24..10-)
    (/note="DEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066-)
    (201..39-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR000591  IPR008936  IPR000198  IPR036388  IPR036390  
  • Prosite: PS50186 PS50238
  • STRING: ENSP00000265036
• Other Databases: GeneCards:  DEPDC1B  Malacards:  DEPDC1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030177	positive regulation of Wnt signaling pathway	IBA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray