• Gene id: 55771

Gene Summary

• Gene Symbol: PRR11   Gene   UCSC   Ensembl
• Gene name: proline rich 11
• Alternate names: proline-rich protein 11, transcription repressor of MHCII,
• Gene location: 17q22 (59155354: 59206708)     Exons: 11     NC_000017.11
• OMIM: 615920

Protein Summary

• Protein general information: Q96HE9  
  • Name: Proline rich protein 11
  • Length: 360  
  • Mass: 40085
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSIDISQSRSWLTSSWNFNFPNIRDAIKL
  WTNRVWSIYSWCQNCITQSLEVLKDTIFPSRICHRELYSVKQQFCILESKLCKLQEALKTISESSSCPSCGQTCH
  MSGKLTNVPACVLITPGDSKAVLPPTLPQPASHFPPPPPPPPLPPPPPPLAPVLLRKPSLAKALQAGPLKKDGPM
  QITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTRVTNVLITPGKSQMDLRKLLR
  KVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLPLSTSSFDEQN

• Structural information:
  • STRING: ENSP00000262293
• Other Databases: GeneCards:  PRR11  Malacards:  PRR11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007050	cell cycle arrest	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0051726	regulation of cell cycle	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881