• Gene id: 55711

Gene Summary

• Gene Symbol: FAR2   Gene   UCSC   Ensembl
• Aliases: HEL-S-81, MLSTD1, SDR10E2
• Gene name: fatty acyl-CoA reductase 2
• Alternate names: fatty acyl-CoA reductase 2, epididymis secretory protein Li 81, male sterility domain-containing protein 1, short chain dehydrogenase/reductase family 10E, member 2,
• Gene location: 12p11.22 (29149100: 29335616)     Exons: 14     NC_000012.12
• Gene summary(Entrez): This gene belongs to the short chain dehydrogenase/reductase superfamily. It encodes a reductase enzyme involved in the first step of wax biosynthesis wherein fatty acids are converted to fatty alcohols. The encoded peroxisomal protein utilizes saturated
• OMIM: 610464

Protein Summary

• Protein general information: Q96K12  
  • Name: Fatty acyl CoA reductase 2 (EC 1.2.1.84) (Male sterility domain containing protein 1)
  • Length: 515  
  • Mass: 59438
• Sequence:

  MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQILDSKLFEKVKEVCPNV
  HEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDTLRHAVQLNVTATRQLLLMASQMPKLEAFIH
  ISTAYSNCNLKHIDEVIYPCPVEPKKIIDSLEWLDDAIIDEITPKLIRDWPNIYTYTKALGEMVVQQESRNLNIA
  IIRPSIVGATWQEPFPGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDTVVNLMLAVGWYTAVHRPKST
  LVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQYWNAVSHRAPAIIYDCYLRLTGRKP
  RMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM
  AGIPKAKQRLKRLRNIHYLFNTALFLIAWRLLIARSQMARNVWFFIVSFCYKFLSYFRASSTLKV

• Structural information:
  • Interpro: IPR026055  IPR033640  IPR013120  IPR036291  
  • CDD: cd09071
  • STRING: ENSP00000443291
• Other Databases: GeneCards:  FAR2  Malacards:  FAR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035336	long-chain fatty-acyl-CoA metabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0080019	fatty-acyl-CoA reductase (alcohol-forming) activity	IBA	molecular function
GO:0005777	peroxisome	IBA	cellular component
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0080019	fatty-acyl-CoA reductase (alcohol-forming) activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0102965	alcohol-forming fatty acyl-CoA reductase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0010025	wax biosynthetic process	TAS	biological process
GO:0016491	oxidoreductase activity	TAS	molecular function
GO:0080019	fatty-acyl-CoA reductase (alcohol-forming) activity	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0035336	long-chain fatty-acyl-CoA metabolic process	IDA	biological process
GO:0080019	fatty-acyl-CoA reductase (alcohol-forming) activity	IDA	molecular function
GO:0005777	peroxisome	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq