• Gene id: 55640

Gene Summary

• Gene Symbol: FLVCR2   Gene   UCSC   Ensembl
• Aliases: C14orf58, CCT, EPV, FLVCRL14q, MFSD7C, PVHH, SLC49A2
• Gene name: FLVCR heme transporter 2
• Alternate names: feline leukemia virus subgroup C receptor-related protein 2, calcium-chelate transporter, feline leukemia virus subgroup C cellular receptor family member 2,
• Gene location: 14q24.3 (75578619: 75648166)     Exons: 11     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline
• OMIM: 610865

Protein Summary

• Protein general information: Q9UPI3  
  • Name: Feline leukemia virus subgroup C receptor related protein 2 (Calcium chelate transporter) (CCT)
  • Length: 526  
  • Mass: 57241
  • Tissue specificity: Expressed in non-hematopoietic tissues, with relative abundant expression in brain, placenta, lung, liver and kidney. Also expressed in hematopoietic tissues (fetal liver, spleen, lymph node, thymus, leukocytes and bone marrow). Found
• Sequence:

  MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSSGPEDL
  SVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLPVAWLLEKFGL
  RTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANEVSTACSVAVFGNQLG
  IAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPPSRAQSLSYALTSPDASYLGS
  IARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYK
  ETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLPLGFEFAVELTYPESEGISSGLLNISAQVFG
  IIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDH
  L

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000238667
• Other Databases: GeneCards:  FLVCR2  Malacards:  FLVCR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097037	heme export	IBA	biological process
GO:0020037	heme binding	IBA	molecular function
GO:0015232	heme transmembrane transporter activity	IBA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0015232	heme transmembrane transporter activity	IDA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome	KEGG:H01120
Proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome	KEGG:H01120
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R