• Gene id: 55634

Gene Summary

• Gene Symbol: KRBOX4   Gene   UCSC   Ensembl
• Aliases: ZNF673
• Gene name: KRAB box domain containing 4
• Alternate names: KRAB domain-containing protein 4, KRAB box domain-containing protein 4, putative zinc finger transcription factor, zinc finger family member 673, zinc finger protein 673,
• Gene location: Xp11.3 (46447188: 46474638)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This encodes a zinc finger protein with an N-terminal KRAB (Kruppel-associated) domain found in transcriptional repressors. This gene is located in a region of the X chromosome thought to be involved in nonsyndromic X-linked cognitive disability. Multiple
• OMIM: 300585

Protein Summary

• Protein general information: Q5JUW0  
  • Name: KRAB domain containing protein 4 (KRAB box domain containing protein 4)
  • Length: 171  
  • Mass: 20100
  • Tissue specificity: Expressed in brain, ovary, testis, prostate, tonsil, heart, bone marrow, colon, breast and kidney. {ECO
• Sequence:

  MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPV
  RTCAGEDRPEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWE
  KAFKTSFKLSWSKWKLCKKER

• Structural information:
  • Protein Domains: (8..7-)
    (/note="KRAB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  
  • Prosite: PS50805
  • CDD: cd07765
  • STRING: ENSP00000345797
• Other Databases: GeneCards:  KRBOX4  Malacards:  KRBOX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881