• Gene id: 55621

Gene Summary

• Gene Symbol: TRMT1   Gene   UCSC   Ensembl
• Aliases: MRT68, TRM1
• Gene name: tRNA methyltransferase 1
• Alternate names: tRNA (guanine(26)-N(2))-dimethyltransferase, N(2),N(2)-dimethylguanosine tRNA methyltransferase, TRM1 tRNA methyltransferase 1 homolog, tRNA 2,2-dimethylguanosine-26 methyltransferase, tRNA methyltransferase 1 homolog, tRNA(guanine-26,N(2)-N(2)) methyltransfer,
• Gene location: 19p13.13 (13117566: 13104899)     Exons: 17     NC_000019.10
• Gene summary(Entrez): This gene encodes a tRNA-modifying enzyme that acts as a dimethyltransferase, modifying a single guanine residue at position 26 of the tRNA. The encoded enzyme has both mono- and dimethylase activity when exogenously expressed, and uses S-adenosyl methion

Protein Summary

• Protein general information: Q9NXH9  
  • Name: tRNA (guanine(26) N(2)) dimethyltransferase (EC 2.1.1.216) (tRNA 2,2 dimethylguanosine 26 methyltransferase) (tRNA(guanine 26,N(2) N(2)) methyltransferase) (tRNA(m(2,2)G26)dimethyltransferase)
  • Length: 659  
  • Mass: 72234
• Sequence:

  MQGSSLWLSLTFRSARVLSRARFFEWQSPGLPNTAAMENGTGPYGEERPREVQETTVTEGAAKIAFPSANEVFYN
  PVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDLSEQEEEKVELKESENLASGDQPRTAAVGEIC
  EEGLHVLEGLAASGLRSIRFALEVPGLRSVVANDASTRAVDLIRRNVQLNDVAHLVQPSQADARMLMYQHQRVSE
  RFDVIDLDPYGSPATFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSLD
  LRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVGCGAFHLQRLGKASGVPSGRAKFSAA
  CGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQ
  LSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSV
  EPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAAR
  LKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID

• Structural information:
  • Protein Domains: (55..49-)
    (/note="Trm1-methyltransferase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00958"-)
  • Interpro: IPR029063  IPR002905  IPR042296  IPR000571  IPR036855  
  • Prosite: PS51626 PS50103
  • STRING: ENSP00000466967
• Other Databases: GeneCards:  TRMT1  Malacards:  TRMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004809	tRNA (guanine-N2-)-methyltransferase activity	IBA	molecular function
GO:0002940	tRNA N2-guanine methylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004809	tRNA (guanine-N2-)-methyltransferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0004809	tRNA (guanine-N2-)-methyltransferase activity	EXP	molecular function
GO:0006400	tRNA modification	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq