• Gene id: 55620

Gene Summary

• Gene Symbol: STAP2   Gene   UCSC   Ensembl
• Aliases: BKS
• Gene name: signal transducing adaptor family member 2
• Alternate names: signal-transducing adaptor protein 2, BRK substrate, breast tumor kinase substrate, brk kinase substrate,
• Gene location: 19p13.3 (4338876: 4324042)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking pro
• OMIM: 603611

Protein Summary

• Protein general information: Q9UGK3  
  • Name: Signal transducing adaptor protein 2 (STAP 2) (Breast tumor kinase substrate) (BRK substrate)
  • Length: 403  
  • Mass: 44894
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEI
  PWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALET
  PSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTS
  LDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPL
  PPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPKVFNGGLGRKLPVSSA
  QPLFPTAGLADMTAELQKKLEKRRALEH

• Structural information:
  • Protein Domains: (18..13-)
    (/note="PH-)
    (133..24-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR011993  IPR000980  IPR036860  IPR039111  IPR035878  
  • Prosite: PS50001
  • CDD: cd10404
  • PDB: 2EL8
  • PDBsum: 2EL8
• Other Databases: GeneCards:  STAP2  Malacards:  STAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035591	signaling adaptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881