• Gene id: 55615

Gene Summary

• Gene Symbol: PRR5   Gene   UCSC   Ensembl
• Aliases: FLJ20185k, PP610, PROTOR-1, PROTOR1
• Gene name: proline rich 5
• Alternate names: proline-rich protein 5, Rho GTPase activating protein 8, proline rich 5 (renal), protein observed with Rictor-1,
• Gene location: 22q13.31 (44668546: 44737680)     Exons: 11     NC_000022.11
• Gene summary(Entrez): This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian

Protein Summary

• Protein general information: P85299  
  • Name: Proline rich protein 5 (Protein observed with Rictor 1) (Protor 1)
  • Length: 388  
  • Mass: 42753
  • Tissue specificity: Most abundant in kidney and liver. Also highly expressed in brain, spleen, testis and placenta. Overexpressed in several colorectal tumors. {ECO
• Sequence:

  MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNEGVRQLL
  KTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWDFFFSDVLPMLQAIFYPVQGKEPSVRQLALL
  HFRNAITLSVKLEDALARAHARVPPAIVQMLLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHSSEGPFT
  HSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPG
  QGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGM
  SDLEGSGGRQSVV

• Structural information:
  • Interpro: IPR013745  IPR016159  
  • STRING: ENSP00000384848
• Other Databases: GeneCards:  PRR5  Malacards:  PRR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038203	TORC2 signaling	IBA	biological process
GO:0031932	TORC2 complex	IBA	cellular component
GO:0031932	TORC2 complex	IDA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0032148	activation of protein kinase B activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq