• Gene id: 55578

Gene Summary

• Gene Symbol: SUPT20H   Gene   UCSC   Ensembl
• Aliases: C13, C13orf19, FAM48A, FP757, P38IP, SPT20
• Gene name: SPT20 homolog, SAGA complex component
• Alternate names: transcription factor SPT20 homolog, family with sequence similarity 48, member A, protein FAM48A, suppressor of Ty 20 homolog, transcription factor (p38 interacting protein), tumor rejection antigen,
• Gene location: 13q13.3 (3611638: 3579652)     Exons: 17     NC_000016.10
• OMIM: 613417

Protein Summary

• Protein general information: Q8NEM7  
  • Name: Transcription factor SPT20 homolog (p38 interacting protein) (p38IP)
  • Length: 779  
  • Mass: 85789
  • Tissue specificity: Highly expressed in testis, moderately in brain and pituitary gland. Expressed in several fetal tissues, including lung, brain, thymus and kidney. Expression is down-regulated in malignant prostate tissues. {ECO
• Sequence:

  MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQETLSC
  LVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQ
  SSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLDPSIAVTCTANRLLYN
  KQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCNL
  AIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEE
  SDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCPVKMSHSSSGSASLSQVSPGKETDQTETVSV
  QSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSP
  ASSSQRTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQ
  AASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQ
  ALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAA
  QTAQLHHHRHTGSQSKSKMKRGTPTTPKF

• Structural information:
  • Interpro: IPR021950  
• Other Databases: GeneCards:  SUPT20H  Malacards:  SUPT20H

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000124	SAGA complex	IBA	cellular component
GO:0000124	SAGA complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0007369	gastrulation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070461	SAGA-type complex	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)