• Gene id: 55527

Gene Summary

• Gene Symbol: FEM1A   Gene   UCSC   Ensembl
• Aliases: EPRAP
• Gene name: fem-1 homolog A
• Alternate names: protein fem-1 homolog A, FEM1-alpha, prostaglandin E receptor 4-associated protein,
• Gene location: 19p13.3 (4791733: 4801272)     Exons: 1     NC_000019.10
• OMIM: 605084

Protein Summary

• Protein general information: Q9BSK4  
  • Name: Protein fem 1 homolog A (FEM1a) (FEM1 alpha) (Prostaglandin E receptor 4 associated protein)
  • Length: 669  
  • Mass: 73639
  • Tissue specificity: Present in macrophages derived from peripheral blood monocytes. Also present in atheromata (at protein level). {ECO
• Sequence:

  MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYLVDRCGASVEAGGSVH
  FDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHG
  HTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVT
  GHTNIVEYLIQEQPGQEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA
  LELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDYSREVNTTEELEALITDPDEMRMQAL
  LIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQQSNLEPLSPMTASSFLSFAELFSYVLQDRA
  AKGSLGTQIGFADLMGVLTKGVREVERALQLPREPGDSAQFTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRL
  LKCAPRGKNGFTPLHMAVDKDTTNVGRYPVGRFPSLHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNAL
  IEAGAHMDATNAFKKTAYELLDEKLLARGTMQPFNYVTLQCLAARALDKNKIPYKGFIPEDLEAFIELH

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR011990  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000269856
• Other Databases: GeneCards:  FEM1A  Malacards:  FEM1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0051438	regulation of ubiquitin-protein transferase activity	ISS	biological process
GO:0031867	EP4 subtype prostaglandin E2 receptor binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881