• Gene id: 55504

Gene Summary

• Gene Symbol: TNFRSF19   Gene   UCSC   Ensembl
• Aliases: TAJ, TAJ-alpha, TRADE, TROY
• Gene name: TNF receptor superfamily member 19
• Alternate names: tumor necrosis factor receptor superfamily member 19, toxicity and JNK inducer,
• Gene location: 13q12.12 (190514084: 190659749)     Exons: 16     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed
• OMIM: 606122

Protein Summary

• Protein general information: Q9NS68  
  • Name: Tumor necrosis factor receptor superfamily member 19 (TRADE) (Toxicity and JNK inducer)
  • Length: 423  
  • Mass: 46015
  • Tissue specificity: Highly expressed in prostate. Detected at lower levels in thymus, spleen, testis, uterus, small intestine, colon and peripheral blood leukocytes.
• Sequence:

  MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTC
  RLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCA
  SKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQ
  LHEYAHRACCQCRRDSVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSI
  CGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSNSSQDLVGGAVPVQSHSENFTAATDL
  SRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRLGSL

• Structural information:
  • Interpro: IPR001368  IPR022342  IPR034047  
  • Prosite: PS00652 PS50050
  • CDD: cd13418
  • STRING: ENSP00000371693
• Other Databases: GeneCards:  TNFRSF19  Malacards:  TNFRSF19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0001942	hair follicle development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0007254	JNK cascade	NAS	biological process
GO:0005031	tumor necrosis factor-activated receptor activity	NAS	molecular function
GO:0006915	apoptotic process	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881