• Gene id: 5550

Gene Summary

• Gene Symbol: PREP   Gene   UCSC   Ensembl
• Aliases: PE, PEP
• Gene name: prolyl endopeptidase
• Alternate names: prolyl endopeptidase, dJ355L5.1 (prolyl endopeptidase), post-proline cleaving enzyme, prolyl oligopeptidase,
• Gene location: 6q21 (105403101: 105273217)     Exons: 17     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be invo
• OMIM: 611359

Protein Summary

• Protein general information: P48147  
  • Name: Prolyl endopeptidase (PE) (EC 3.4.21.26) (Post proline cleaving enzyme)
  • Length: 710  
  • Mass: 80700
• Sequence:

  MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPK
  YSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDW
  VTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILC
  AEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVF
  TFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNILQLHDLTTGALLKTF
  PLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPSKDGTKI
  PMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQN
  CFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
  CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVD
  TKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP

• Structural information:
  • Interpro: IPR029058  IPR002471  IPR023302  IPR001375  IPR002470  
  • Prosite: PS00708
  • PDB: 3DDU
  • PDBsum: 3DDU
  • STRING: ENSP00000358106
• Other Databases: GeneCards:  PREP  Malacards:  PREP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0004175	endopeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0070012	oligopeptidase activity	IBA	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0070008	serine-type exopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq