• Gene id: 5549

Gene Summary

• Gene Symbol: PRELP   Gene   UCSC   Ensembl
• Aliases: MST161, MSTP161, SLRR2A
• Gene name: proline and arginine rich end leucine rich repeat protein
• Alternate names: prolargin, 55 kDa leucine-rich repeat protein of articular cartilage, prolargin proteoglycan, proline-arginine-rich end leucine-rich repeat protein,
• Gene location: 1q32.1 (203475805: 203491351)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind
• OMIM: 601914

Protein Summary

• Protein general information: P51888  
  • Name: Prolargin (Proline arginine rich end leucine rich repeat protein)
  • Length: 382  
  • Mass: 43810
  • Tissue specificity: Connective tissue.
• Sequence:

  MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIFPDCPR
  ECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRKIDQRVLEKLP
  GLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDGVFKPDTFHGLKNLMQ
  LNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
  NRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPPIPLDLMMCFR
  LLQSVVI

• Structural information:
  • Interpro: IPR001611  IPR003591  IPR032675  IPR000372  IPR027216  
  • Prosite: PS51450
  • STRING: ENSP00000343924
• Other Databases: GeneCards:  PRELP  Malacards:  PRELP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008201	heparin binding	IBA	molecular function
GO:0005201	extracellular matrix structural constituent	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005201	extracellular matrix structural constituent	TAS	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0031012	extracellular matrix	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0018146	keratan sulfate biosynthetic process	TAS	biological process
GO:0042340	keratan sulfate catabolic process	TAS	biological process
GO:0007569	cell aging	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	ISS	molecular function
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)