• Gene id: 55435

Gene Summary

• Gene Symbol: AP1AR   Gene   UCSC   Ensembl
• Aliases: 2C18, C4orf16, GBAR, PRO0971, gamma-BAR
• Gene name: adaptor related protein complex 1 associated regulatory protein
• Alternate names: AP-1 complex-associated regulatory protein, adapter-related protein complex 1-associated regulatory protein, gadkin, gamma-1-adaptin brefeldin A resistance protein, gamma-A1-adaptin and kinesin interactor, gamma1-adaptin brefeldin A resistance protein, gamma-B,
• Gene location: 4q25 (112231786: 112273109)     Exons: 12     NC_000004.12
• OMIM: 610851

Protein Summary

• Protein general information: Q63HQ0  
  • Name: AP 1 complex associated regulatory protein (2c18) (Adaptor related protein complex 1 associated regulatory protein) (Gamma 1 adaptin brefeldin A resistance protein) (GBAR) (Gamma BAR) (Gamma A1 adaptin and kinesin interactor) (Gadkin)
  • Length: 302  
  • Mass: 34280
• Sequence:

  MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRER
  HYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAAKQRKLLEQERQRIVQQYHPSNNGEYQSSGP
  EDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRER
  SKTEEDILRAALKYSNKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQ
  TR

• Structural information:
  • Interpro: IPR031483  
  • STRING: ENSP00000274000
• Other Databases: GeneCards:  AP1AR  Malacards:  AP1AR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048203	vesicle targeting, trans-Golgi to endosome	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0035650	AP-1 adaptor complex binding	IBA	molecular function
GO:0019894	kinesin binding	IBA	molecular function
GO:0048203	vesicle targeting, trans-Golgi to endosome	IDA	biological process
GO:0035650	AP-1 adaptor complex binding	IDA	molecular function
GO:0019894	kinesin binding	IDA	molecular function
GO:0001920	negative regulation of receptor recycling	IMP	biological process
GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0048203	vesicle targeting, trans-Golgi to endosome	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:2000146	negative regulation of cell motility	IEA	biological process
GO:0035650	AP-1 adaptor complex binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0030133	transport vesicle	IDA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0034315	regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:2000146	negative regulation of cell motility	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881