• Gene id: 55374

Gene Summary

• Gene Symbol: TMCO6   Gene   UCSC   Ensembl
• Aliases: PRO1580
• Gene name: transmembrane and coiled-coil domains 6
• Alternate names: transmembrane and coiled-coil domain-containing protein 6,
• Gene location: 5q31.3 (133358030: 133352772)     Exons: 7     NC_000010.11

Protein Summary

• Protein general information: Q96DC7  
  • Name: Transmembrane and coiled coil domain containing protein 6
  • Length: 493  
  • Mass: 54442
• Sequence:

  MWSRRQGRLRPTVCGVEELRRRRREREAALRKARREQQLVSKRLLRNDAPEEAGEGCVAAILGETEVQQFLRQAQ
  RGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSNQALLQLEAARCLHELSHSEQSTVAEACLPA
  TSYLLTYLSSHSSDFIELCLYTLGNLIVESEAVRRQLLPQGIVPALAACIQSPHVAVLEALGYALSQLLQAEEAP
  EKIIPSILASTLPQHMLQMLQPGPKLNPGVAVEFAWCLHYIICSQVSNPLLIGHGALSTLGLLLLDLAGAVQKTE
  DAGLELLACPVLRCLSNLLTEAAVETVGGQMQLRDERVVAALFILLQFFFQKQPSLLPEGLWLLNNLTANSPSFC
  TSLLSLDLIEPLLQLLPVSNVVSVMVLTVLCNVAEKGPAYCQRLWPGPLLPALLHTLAFSDTEVVGQSLELLHLL
  FLYQPEAVQVFLQQSGLQALERHQEEAQLQDRVYALQQTALQG

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR000225  IPR002652  
  • STRING: ENSP00000252100
• Other Databases: GeneCards:  TMCO6  Malacards:  TMCO6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0006606	protein import into nucleus	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq