• Gene id: 55350

Gene Summary

• Gene Symbol: VNN3   Gene   UCSC   Ensembl
• Aliases: HSA238982
• Gene name: vanin 3
• Alternate names: vascular non-inflammatory molecule 3, pantetheinase pseudogene, pantetheinase-associated gene expressed in leukocytes (PAGEL)-alpha, vanin 1 pseudogene,
• Gene location: 6q23.2 (132734764: 132722786)     Exons: 8     NC_000006.12
• Gene summary(Entrez): This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq, Apr 2014]
• OMIM: 602749

Protein Summary

• Protein general information: Q9NY84  
  • Name: Vascular non inflammatory molecule 3 (Vanin 3) (EC 3.5.1.92)
  • Length: 501  
  • Mass: 56118
  • Tissue specificity: Widely expressed with higher expression in liver and blood. Expressed in differentiated keratinocytes in epidermis and in epithelial cells in dermis. Overexpressed in lesional psoriatic skin. {ECO
• Sequence:

  MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHI
  IVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRFGNTPVQQRLSCLAKDNSIYVVANIGDKKPCNASD
  SQCPPDGRYQYNTDVVFDSQGKLLARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVV
  DEVSIDSILYPTAWYNTLPLLSAVPFHSAWAKAMGVNLLAANTHNTSMHMTGSGIYAPEAVKVYHYDMETESGQL
  LLSELKSRPRREPTYPAAVDWHAYASSVKPFSSEQSDFLGMIYFDEFTFTKLKRNTGNYTACQKDLCCHLTYKMS
  EKRTDEIYALGAFDGLHTVEGQYYLQICALLKCQTTDLETCGEPVGSAFTKFEDFSLSGTFGTRYVFPQIILSGS
  QLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDPPRLGQGSGKFQ

• Structural information:
  • Protein Domains: (31..30-)
    (/note="CN-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00054"-)
  • Interpro: IPR012101  IPR040154  IPR003010  IPR036526  
  • Prosite: PS50263
  • CDD: cd07567
  • STRING: ENSP00000440594
• Other Databases: GeneCards:  VNN3  Malacards:  VNN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015939	pantothenate metabolic process	IBA	biological process
GO:0017159	pantetheine hydrolase activity	IBA	molecular function
GO:0006807	nitrogen compound metabolic process	IEA	biological process
GO:0016811	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0017159	pantetheine hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0017159	pantetheine hydrolase activity	NAS	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa00770	Pantothenate and CoA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881