• Gene id: 55347

Gene Summary

• Gene Symbol: ABHD10   Gene   UCSC   Ensembl
• Gene name: abhydrolase domain containing 10, depalmitoylase
• Alternate names: mycophenolic acid acyl-glucuronide esterase, mitochondrial, abhydrolase domain containing 10, abhydrolase domain-containing protein 10, mitochondrial, alpha/beta hydrolase domain-containing protein 10, mitochondrial,
• Gene location: 3q13.2 (111979025: 111993367)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes a mitochondrially-localized enzyme that acts in liver cells as a hydrolase. The encoded protein removes glucuronide from mycophenolic acid acyl-glucuronide. There is a pseudogene for this gene on chromosome 6. Alternative splicing result
• OMIM: 618756

Protein Summary

• Protein general information: Q9NUJ1  
  • Name: Mycophenolic acid acyl glucuronide esterase, mitochondrial (EC 3.1.1.93) (Alpha/beta hydrolase domain containing protein 10) (Abhydrolase domain containing protein 10)
  • Length: 306  
  • Mass: 33933
• Sequence:

  MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKKLKGKS
  PGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVG
  SSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSMPSKYSEEGVYNVQYSFIKEA
  EHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHRMREKADIQLLVYTIDDLIDK
  LSTIVN

• Structural information:
  • Protein Domains: (78..17-)
    (/note="AB-hydrolase-1)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR029058  IPR000073  
  • DIP: 56934
  • STRING: ENSP00000273359
• Other Databases: GeneCards:  ABHD10  Malacards:  ABHD10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0102390	mycophenolic acid acyl-glucuronide esterase activity	IEA	molecular function
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	TAS	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0052695	cellular glucuronidation	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0019391	glucuronoside catabolic process	IDA	biological process
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881