• Gene id: 55335

Gene Summary

• Gene Symbol: NIPSNAP3B   Gene   UCSC   Ensembl
• Aliases: FP944, NIPSNAP3, SNAP1
• Gene name: nipsnap homolog 3B
• Alternate names: protein NipSnap homolog 3B,
• Gene location: 9q31.1 (104763740: 104777763)     Exons: 8     NC_000009.12
• Gene summary(Entrez): NIPSNAP3B belongs to a family of proteins with putative roles in vesicular trafficking (Buechler et al., 2004 [PubMed 15177564]).[supplied by OMIM, Mar 2008]
• OMIM: 608872

Protein Summary

• Protein general information: Q9BS92  
  • Name: Protein NipSnap homolog 3B (NipSnap3B) (SNAP1)
  • Length: 247  
  • Mass: 28313
• Sequence:

  MLVLRSGLTKALASRTLAPQVCSSFATGPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNIHLRTSYSELVGFWSV
  EFGGRTNKVFHIWKYDNFAHRAEVRKALANCKEWQEQSIIPNLARIDKQETEITYLIPWSKLEKPPKEGVYELAV
  FQMKPGGPALWGDAFERAINAHVNLGYTKVVGVFHTEYGELNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRE
  SVNYLVSQQNMLLIPASFSPLK

• Structural information:
  • Interpro: IPR011008  IPR012577  
  • STRING: ENSP00000363894
• Other Databases: GeneCards:  NIPSNAP3B  Malacards:  NIPSNAP3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881