• Gene id: 55332

Gene Summary

• Gene Symbol: DRAM1   Gene   UCSC   Ensembl
• Aliases: DRAM
• Gene name: DNA damage regulated autophagy modulator 1
• Alternate names: DNA damage-regulated autophagy modulator protein 1, damage-regulated autophagy modulator,
• Gene location: 12q23.2 (101877326: 101923622)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various
• OMIM: 610776

Protein Summary

• Protein general information: Q8N682  
  • Name: DNA damage regulated autophagy modulator protein 1 (Damage regulated autophagy modulator)
  • Length: 238  
  • Mass: 26253
• Sequence:

  MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAATMYTRY
  KIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPVVHDGGALLAFVCGVVYTLLQSIISYKSCPQ
  WNSLSTCHIRMVISAVSCAAVIPMIVCASLISITKLEWNPREKDYVYHVVSAICEWTVAFGFIFYFLTFIQDFQS
  VTLRISTEINGDI

• Structural information:
  • Interpro: IPR019402  
  • STRING: ENSP00000258534
• Other Databases: GeneCards:  DRAM1  Malacards:  DRAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010506	regulation of autophagy	IDA	biological process
GO:0005764	lysosome	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray