Search Result
| Gene id | 55311 | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
| Gene Symbol | ZNF444 Gene UCSC Ensembl | ||||||||||||||||||||||||||||
| Aliases | EZF-2, EZF2, ZSCAN17 | ||||||||||||||||||||||||||||
| Gene name | zinc finger protein 444 | ||||||||||||||||||||||||||||
| Alternate names | zinc finger protein 444, endothelial zinc finger protein 2, zinc finger and SCAN domain-containing protein 17, | ||||||||||||||||||||||||||||
| Gene location |
19q13.43 (56132508: 56160892) Exons: 12 NC_000019.10 |
||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a zinc finger protein which activates transcription of a scavenger receptor gene involved in the degradation of acetylated low density lipoprotein (Ac-LDL) (PMID: 11978792). This gene is located in a cluster of zinc finger genes on chrom |
||||||||||||||||||||||||||||
| OMIM | 607874 | ||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
| Protein general information | Q8N0Y2 Name: Zinc finger protein 444 (Endothelial zinc finger protein 2) (EZF 2) (Zinc finger and SCAN domain containing protein 17) Length: 327 Mass: 35204 | ||||||||||||||||||||||||||||
| Sequence |
MEVAVPVKQEAEGLALDSPWHRFRRFHLGDAPGPREALGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPAD TQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPAPGDS QAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGEKPHACPECGKAFRRKEHLRRH RDTHPGSPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH GRAAASAQGAVAPGPDGGGPFPPWPLG | ||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||
| Other Databases | GeneCards: ZNF444  Malacards: ZNF444 | ||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||