Search Result
| Gene id | 55303 | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
| Gene Symbol | GIMAP4 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
| Aliases | IAN-1, IAN1, IMAP4, MSTP062 | ||||||||||||||||||||||||||||||||
| Gene name | GTPase, IMAP family member 4 | ||||||||||||||||||||||||||||||||
| Alternate names | GTPase IMAP family member 4, human immune associated nucleotide 1, immune-associated nucleotide-binding protein 1, immunity associated protein 4, immunity-associated nucleotide 1 protein, | ||||||||||||||||||||||||||||||||
| Gene location |
7q36.1 (150567369: 150573952) Exons: 3 NC_000007.14 |
||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia |
||||||||||||||||||||||||||||||||
| OMIM | 618448 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
| Protein general information | Q9NUV9 Name: GTPase IMAP family member 4 (Immunity associated nucleotide 1 protein) (IAN 1) (hIAN1) (Immunity associated protein 4) Length: 329 Mass: 37534 Tissue specificity: Highly expressed in spleen and peripheral blood leukocytes that contain mostly T- and B-lymphocytes. Expressed specifically in resting T- and B-lymphocytes and expression significantly decreases during B- or T-lymphocyte activation. Ex | ||||||||||||||||||||||||||||||||
| Sequence |
MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCEKRSSS WKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKMFGERARSFMI LIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRM YQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQMEKKLAEQEAHYAVRQQRARTE VESKDGILELIMTALQIASFILLRLFAED | ||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: GIMAP4  Malacards: GIMAP4 | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||