• Gene id: 55298

Gene Summary

• Gene Symbol: RNF121   Gene   UCSC   Ensembl
• Gene name: ring finger protein 121
• Alternate names: RING finger protein 121,
• Gene location: 11q13.4 (71928700: 71997596)     Exons: 11     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Several alternatively spliced transcript variants have been n

Protein Summary

• Protein general information: Q9H920  
  • Name: RING finger protein 121
  • Length: 327  
  • Mass: 37882
• Sequence:

  MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHAEMVLILIATLVVAQLLLVQWKQR
  HPRSYNMVTLFQMWVVPLYFTVKLHWWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG
  IVGYMAVMFTLFGLNLLFKIKPEDAMDFGISLLFYGLYYGVLERDFAEMCADYMASTIGFYSESGMPTKHLSDSV
  CAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLL
  DWLRYLVAWQPVIIGVVQGINYILGLE

• Structural information:
  • Interpro: IPR040176  IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000354571
• Other Databases: GeneCards:  RNF121  Malacards:  RNF121

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0000139	Golgi membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0030968	endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881