• Gene id: 55289

Gene Summary

• Gene Symbol: ACOXL   Gene   UCSC   Ensembl
• Gene name: acyl-CoA oxidase like
• Alternate names: acyl-coenzyme A oxidase-like protein, acyl-CoA oxidase-like protein,
• Gene location: 2q13 (110732538: 111120609)     Exons: 34     NC_000002.12
• OMIM: 608991

Protein Summary

• Protein general information: Q9NUZ1  
  • Name: Acyl coenzyme A oxidase like protein (Acyl CoA oxidase like protein) (EC 1.3.3. )
  • Length: 547  
  • Mass: 61795
• Sequence:

  MRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVT
  KWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMYIGNAMYGNYAAVFAQLIIDG
  RSQGPHCFIVPVRDENGSLYPGVTAIDMMYKEGLHGVDNGILIFDKVRIPRENLLDKFGSVAPDGQYHSPIRNKS
  ARFNAMLAALTPSRLAVAFQAMGAMKLGLTIAIRYSHSRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFV
  SRYAGALLDEDVFQGKELVNSRSLQALVAGLKAYSTWENIRCLQDCRECTGGMGYMMENRISGLKCDTDVFATFE
  GDDVVMLQVVGRELLAQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVKFRERVLQRGL
  VARIYYKVKTKKEDFFHAWNSCLHHVASLSLAHTHRVTLEQFSLAVKSCPDQEDQTLLMKFCLLYGTKLVFQERA
  WYLEHKYLTPMASTRIRNQERC

• Structural information:
  • Interpro: IPR006091  IPR002655  IPR036250  IPR009075  IPR009100  
  • STRING: ENSP00000407761
• Other Databases: GeneCards:  ACOXL  Malacards:  ACOXL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050660	flavin adenine dinucleotide binding	IBA	molecular function
GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	IBA	biological process
GO:0005504	fatty acid binding	IBA	molecular function
GO:0003997	acyl-CoA oxidase activity	IBA	molecular function
GO:0055088	lipid homeostasis	IBA	biological process
GO:0005777	peroxisome	IBA	cellular component
GO:0003997	acyl-CoA oxidase activity	IEA	molecular function
GO:0006635	fatty acid beta-oxidation	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0033540	fatty acid beta-oxidation using acyl-CoA oxidase	TAS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq