|
Gene id |
55272 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
IMP3 Gene UCSC Ensembl |
|
Aliases |
BRMS2, C15orf12, MRPS4 |
|
Gene name |
IMP U3 small nucleolar ribonucleoprotein 3 |
|
Alternate names |
U3 small nucleolar ribonucleoprotein protein IMP3, IMP3, U3 small nucleolar ribonucleoprotein, homolog, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3, |
|
Gene location |
15q24.2 (75640322: 75639084) Exons: 1 NC_000015.10
|
|
Gene summary(Entrez) |
This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. [provided by RefSeq, Jul 2008]
|
|
OMIM |
612980 |
Protein Summary
|
| Protein general information
| Q9NV31
Name: U3 small nucleolar ribonucleoprotein protein IMP3 (U3 snoRNP protein IMP3) (BRMS2)
Length: 184 Mass: 21850
|
| Sequence |
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRA SAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLV TRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
|
| Structural information |
|
| Other Databases |
GeneCards: IMP3  Malacards: IMP3 |
|
|
|
|
| Pathway id | Pathway name |
| hsa03008 | Ribosome biogenesis in eukaryotes | |
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
|