• Gene id: 55262

Gene Summary

• Gene Symbol: MAP11   Gene   UCSC   Ensembl
• Aliases: C7orf43, MCPH25, TRAPPC14
• Gene name: microtubule associated protein 11
• Alternate names: microtubule-associated protein 11, uncharacterized protein C7orf43,
• Gene location: 7q22.1 (100158722: 100154422)     Exons: 9     NC_000007.14
• OMIM: 618350

Protein Summary

• Protein general information: Q8WVR3  
  • Name: Microtubule associated protein 11
  • Length: 580  
  • Mass: 62597
  • Tissue specificity: Broadly expressed. High levels in brain, cerebellum, testis and whole blood. {ECO
• Sequence:

  MESQCDYSMYFPAVPLPPRAELAGDPGRYRALPRRNHLYLGETVRFLLVLRCRGGAGSGTGGGPGLGSRGAWAEL
  ATALAALASVSAGGGMPGGGGAGDQDSEPPGGGDPGGGGLFRGCSPLLTHGPGPATSGGATTLPVEEPIVSTDEV
  IFPLTVSLDRLPPGTPKAKIVVTVWKREIEAPEVRDQGYLRLLQTRSPGETFRGEQSAFKAQVSTLLTLLPPPVL
  RCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTS
  GCFPCPLNALEEHNFLFQLRGGEQPPPGAKEGLEVPLIAVVQWSTPKLPFTQSIYTHYRLPSVRLDRPCFVMTAS
  CKSPVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQAGKQLCEEERRAMQAALDSVVCHTPLNNLGFSRKGSAL
  TFSVAFQALRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSR
  SHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVEPVK

• Structural information:
  • Interpro: IPR031626  
  • STRING: ENSP00000324741
• Other Databases: GeneCards:  MAP11  Malacards:  MAP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0043014	alpha-tubulin binding	IDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component

Diseases

Associated diseases	References
Primary microcephaly	KEGG:H00269
Primary microcephaly	KEGG:H00269
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)