• Gene id: 55255

Gene Summary

• Gene Symbol: WDR41   Gene   UCSC   Ensembl
• Aliases: MSTP048
• Gene name: WD repeat domain 41
• Alternate names: WD repeat-containing protein 41,
• Gene location: 5q13.3-q14.1 (77620610: 77426651)     Exons: 15     NC_000005.10
• OMIM: 617502

Protein Summary

• Protein general information: Q9HAD4  
  • Name: WD repeat containing protein 41
  • Length: 459  
  • Mass: 51728
• Sequence:

  MLRWLIGGGREPQGLAEKSPLQTIGEEQTQNPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWNAQTGE
  KLLELNGHTQKITAIITFPSLESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLTVLQRLDVWLS
  GGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPKNCVVAAVGKELIIFRLVAPTEGSLEWDILEVKRLLDHQDNI
  LSLINVNDLSFVTGSHVGELIIWDALDWTMQAYERNFWDPSPQLDTQQEIKLCQKSNDISIHHFTCDEENVFAAV
  GRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWELREKQQLAAEPVPTGFFNMWGFGRV
  SKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGLRSLRLFQKLE
  ENGDLYLAV

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  IPR040102  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000296679
• Other Databases: GeneCards:  WDR41  Malacards:  WDR41

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990316	Atg1/ULK1 kinase complex	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0010506	regulation of autophagy	IMP	biological process
GO:0010506	regulation of autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0017112	Rab guanyl-nucleotide exchange factor activity	IDA	contributes to
GO:0032045	guanyl-nucleotide exchange factor complex	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)