• Gene id: 55254

Gene Summary

• Gene Symbol: TMEM39A   Gene   UCSC   Ensembl
• Aliases: SUSR2
• Gene name: transmembrane protein 39A
• Alternate names: transmembrane protein 39A, suppressor of SQST-1 aggregates in rpl-43 mutants,
• Gene location: 3q13.33 (119463631: 119428948)     Exons: 11     NC_000003.12

Protein Summary

• Protein general information: Q9NV64  
  • Name: Transmembrane protein 39A
  • Length: 488  
  • Mass: 55667
• Sequence:

  MPGGRRGPSRQQLSRSALPSLQTLVGGGCGNGTGLRNRNGSAIGLPVPPITALITPGPVRHCQIPDLPVDGSLLF
  EFLFFIYLLVALFIQYINIYKTVWWYPYNHPASCTSLNFHLIDYHLAAFITVMLARRLVWALISEATKAGAASMI
  HYMVLISARLVLLTLCGWVLCWTLVNLFRSHSVLNLLFLGYPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVE
  ESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAYYVA
  FLPLCFVKSTQYYDMRWSCEHLIMVWINAFVMLTTQLLPSKYCDLLHKSAAHLGKWQKLEHGSYSNAPQHIWSEN
  TIWPQGVLVRHSRCLYRAMGPYNVAVPSDVSHARFYFLFHRPLRLLNLLILIEGSVVFYQLYSLLRSEKWNHTLS
  MALILFCNYYVLFKLLRDRIVLGRAYSYPLNSYELKAN

• Structural information:
  • Interpro: IPR019397  
  • STRING: ENSP00000326063
• Other Databases: GeneCards:  TMEM39A  Malacards:  TMEM39A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0045070	positive regulation of viral genome replication	IDA	biological process
GO:1901097	negative regulation of autophagosome maturation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902902	negative regulation of autophagosome assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881