• Gene id: 55250

Gene Summary

• Gene Symbol: ELP2   Gene   UCSC   Ensembl
• Aliases: MRT58, SHINC-2, STATIP1, StIP
• Gene name: elongator acetyltransferase complex subunit 2
• Alternate names: elongator complex protein 2, STAT3-interacting protein 1, elongation protein 2 homolog, elongator protein 2, signal transducer and activator of transcription 3 interacting protein 1,
• Gene location: 18q12.2 (36129898: 36180556)     Exons: 23     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene is a core subunit of the elongator complex, a histone acetyltransferase complex that associates with RNA polymerase II. In addition to histone acetylation, the encoded protein effects transcriptional elongation and may hel
• OMIM: 616054

Protein Summary

• Protein general information: Q6IA86  
  • Name: Elongator complex protein 2 (ELP2) (SHINC 2) (STAT3 interacting protein 1) (StIP1)
  • Length: 826  
  • Mass: 92500
• Sequence:

  MVAPVLETSHVFCCPNRVRGVLNWSSGPRGLLAFGTSCSVVLYDPLKRVVVTNLNGHTARVNCIQWICKQDGSPS
  TELVSGGSDNQVIHWEIEDNQLLKAVHLQGHEGPVYAVHAVYQRRTSDPALCTLIVSAAADSAVRLWSKKGPEVM
  CLQTLNFGNGFALALCLSFLPNTDVPILACGNDDCRIHIFAQQNDQFQKVLSLCGHEDWIRGVEWAAFGRDLFLA
  SCSQDCLIRIWKLYIKSTSLETQDDDNIRLKENTFTIENESVKIAFAVTLETVLAGHENWVNAVHWQPVFYKDGV
  LQQPVRLLSASMDKTMILWAPDEESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNTVNP
  REWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKRKDQSQVTWHEIARPQIHGYDLKCLAMINRF
  QFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELL
  TSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWN
  TTSWKQVQNLVFHSLTVTQMAFSPNEKFLLAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSC
  DWSPDSKYFFTGSRDKKVVVWGECDSTDDCIEHNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLECGKIC
  LYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCA
  L

• Structural information:
  • Interpro: IPR037289  IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50082 PS50294
  • DIP: 56235
  • STRING: ENSP00000414851
• Other Databases: GeneCards:  ELP2  Malacards:  ELP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0008023	transcription elongation factor complex	IDA	cellular component
GO:0005737	cytoplasm	NAS	cellular component
GO:0033588	Elongator holoenzyme complex	IBA	cellular component
GO:0008023	transcription elongation factor complex	IBA	cellular component
GO:0033588	Elongator holoenzyme complex	IDA	cellular component
GO:0033588	Elongator holoenzyme complex	IEA	cellular component
GO:0002098	tRNA wobble uridine modification	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0046425	regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0000993	RNA polymerase II complex binding	IDA	contributes to
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)