• Gene id: 55227

Gene Summary

• Gene Symbol: LRRC1   Gene   UCSC   Ensembl
• Aliases: LANO, dJ523E19.1
• Gene name: leucine rich repeat containing 1
• Alternate names: leucine-rich repeat-containing protein 1, LANO adapter protein, LAP (leucine-rich repeats and PDZ) and no PDZ protein, LAP and no PDZ protein,
• Gene location: 6p12.1 (53794496: 53924124)     Exons: 19     NC_000006.12
• OMIM: 608195

Protein Summary

• Protein general information: Q9BTT6  
  • Name: Leucine rich repeat containing protein 1 (LANO adapter protein) (LAP and no PDZ protein)
  • Length: 524  
  • Mass: 59242
  • Tissue specificity: Expressed strongly in testis and placenta, followed by heart, lung, kidney, thyroid, trachea, colon, prostate and pancreas. {ECO
• Sequence:

  MFHCIPLWRCNRHVESIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLP
  PEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNL
  YNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCL
  DVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQ
  LLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATELHVLDVAGNRLLHLPL
  SLTALKLKALWLSDNQSQPLLTFQTDTDYTTGEKILTCVLLPQLPSEPTCQENLPRCGALENLVNDVSDEAWNER
  AVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTTSV

• Structural information:
  • Interpro: IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000359925
• Other Databases: GeneCards:  LRRC1  Malacards:  LRRC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005911	cell-cell junction	IBA	cellular component
GO:0005912	adherens junction	IBA	cellular component
GO:0008328	ionotropic glutamate receptor complex	IBA	colocalizes with
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0030054	cell junction	IBA	cellular component
GO:0097120	receptor localization to synapse	IBA	biological process
GO:0098609	cell-cell adhesion	IBA	biological process
GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:0043113	receptor clustering	IBA	biological process
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	colocalizes with
GO:0097060	synaptic membrane	IBA	colocalizes with
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray