• Gene id: 55218

Gene Summary

• Gene Symbol: EXD2   Gene   UCSC   Ensembl
• Aliases: C14orf114, EXDL2
• Gene name: exonuclease 3'-5' domain containing 2
• Alternate names: exonuclease 3'-5' domain-containing protein 2, 3'-5' exoribonuclease EXD2, exonuclease 3'-5' domain-like 2, exonuclease 3'-5' domain-like-containing protein 2,
• Gene location: 14q24.1 (69191476: 69244019)     Exons: 13     NC_000014.9
• OMIM: 616940

Protein Summary

• Protein general information: Q9NVH0  
  • Name: Exonuclease 3' 5' domain containing protein 2 (EC 3.1.11.1) (3' 5' exoribonuclease EXD2) (EC 3.1.13. ) (Exonuclease 3' 5' domain like containing protein 2)
  • Length: 621  
  • Mass: 70353
• Sequence:

  MSRQNLVALTVTTLLGVAVGGFVLWKGIQRRRRSKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRSSWKERIL
  KAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLEGKASPLSLLQMASPSGLCVLVRLPKLICGGKTLPR
  TLLDILADGTILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLL
  RCSNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSWRKVLEKCQGVVDIPFRSKGMSRL
  GEEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPLYDNCFLHAPDGQPLCTCDRRK
  AQWYLDKGIGELVSEEPFVVKLRFEPAGRPESPGDYYLMVKENLCVVCGKRDSYIRKNVIPHEYRKHFPIEMKDH
  NSHDVLLLCTSCHAISNYYDNHLKQQLAKEFQAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPTQRKEELLQ
  ALREFYNTDVVTEEMLQEAASLETRISNENYVPHGLKVVQCHSQGGLRSLMQLESRWRQHFLDSMQPKHLPQQWS
  VDHNHQKLLRKFGEDLPIQLS

• Structural information:
  • Protein Domains: (155..24-)
    (/note="3'-5'-exonuclease)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR002562  IPR012337  IPR036397  
  • PDB: 6K17 6K18 6K19 6K1A 6K1B 6K1C 6K1D 6K1E
  • PDBsum: 6K17 6K18 6K19 6K1A 6K1B 6K1C 6K1D 6K1E
  • DIP: 61996
  • STRING: ENSP00000313140
• Other Databases: GeneCards:  EXD2  Malacards:  EXD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0008408	3'-5' exonuclease activity	IBA	molecular function
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease activity	IDA	molecular function
GO:0090734	site of DNA damage	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0030145	manganese ion binding	IDA	molecular function
GO:0008296	3'-5'-exodeoxyribonuclease activity	IDA	molecular function
GO:0006302	double-strand break repair	IDA	biological process
GO:0000724	double-strand break repair via homologous recombination	IDA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IDA	biological process
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0000729	DNA double-strand break processing	IDA	biological process
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0031297	replication fork processing	IMP	biological process
GO:0008408	3'-5' exonuclease activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006139	nucleobase-containing compound metabolic process	IEA	biological process
GO:0008408	3'-5' exonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008852	exodeoxyribonuclease I activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)