Search Result
| Gene id | 55213 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | RCBTB1 Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | CLLD7, CLLL7, GLP, RDEOA | ||||||||||||||||||||||||
| Gene name | RCC1 and BTB domain containing protein 1 | ||||||||||||||||||||||||
| Alternate names | RCC1 and BTB domain-containing protein 1, CLL deletion region gene 7 protein, GDP/GTP exchange factor (GEF)-like protein, chronic lymphocytic leukemia deletion region gene 7 protein, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing , | ||||||||||||||||||||||||
| Gene location |
13q14.2 (49585586: 49531943) Exons: 18 NC_000013.11 |
||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of |
||||||||||||||||||||||||
| OMIM | 607867 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q8NDN9 Name: RCC1 and BTB domain containing protein 1 (Chronic lymphocytic leukemia deletion region gene 7 protein) (CLL deletion region gene 7 protein) (Regulator of chromosome condensation and BTB domain containing protein 1) Length: 531 Mass: 58252 Tissue specificity: Ubiquitously expressed (PubMed | ||||||||||||||||||||||||
| Sequence |
MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKK IKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVVEVACGSHHSMALAADGEVF AWGYNNCGQVGSGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPV RVAALHSVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVVEIAACHSAHTSAA KTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEHEDFLTVAESLKKEFDSPETADLKFR IDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIGLLDLATSY CENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASK CGAFKN | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: RCBTB1  Malacards: RCBTB1 | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||