• Gene id: 55153

Gene Summary

• Gene Symbol: SDAD1   Gene   UCSC   Ensembl
• Gene name: SDA1 domain containing 1
• Alternate names: protein SDA1 homolog, SDA1 domain-containing protein 1, nucleolar protein 130,
• Gene location: 4q21.1 (75990961: 75949905)     Exons: 22     NC_000004.12
• OMIM: 0

Protein Summary

• Protein general information: Q9NVU7  
  • Name: Protein SDA1 homolog (Nucleolar protein 130) (SDA1 domain containing protein 1) (hSDA)
  • Length: 687  
  • Mass: 79871
  • Tissue specificity: Highly expressed in testis, kidney, spleen, brain and fetal tissues. Also expressed at lower level in heart, lung, liver, small intestine, ovary, uterus, mammary gland and placenta. {ECO
• Sequence:

  MSNRNNNKLPSNLPQLQNLIKRDPPAYIEEFLQQYNHYKSNVEIFKLQPNKPSKELAELVMFMAQISHCYPEYLS
  NFPQEVKDLLSCNHTVLDPDLRMTFCKALILLRNKNLINPSSLLELFFELFRCHDKLLRKTLYTHIVTDIKNINA
  KHKNNKVNVVLQNFMYTMLRDSNATAAKMSLDVMIELYRRNIWNDAKTVNVITTACFSKVTKILVAALTFFLGKD
  EDEKQDSDSESEDDGPTARDLLVQYATGKKSSKNKKKLEKAMKVLKKQKKKKKPEVFNFSAIHLIHDPQDFAEKL
  LKQLECCKERFEVKMMLMNLISRLVGIHELFLFNFYPFLQRFLQPHQREVTKILLFAAQASHHLVPPEIIQSLLM
  TVANNFVTDKNSGEVMTVGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIHLFRTLNPQMLQKK
  FRGKPTEASIEARVQEYGELDAKDYIPGAEVLEVEKEENAENDEDGWESTSLSEEEDADGEWIDVQHSSDEEQQE
  ISKKLNSMPMEERKAKAAAISTSRVLTQEDFQKIRMAQMRKELDAAPGKSQKRKYIEIDSDEEPRGELLSLRDIE
  RLHKKPKSDKETRLATAMAGKTDRKEFVRKKTKTNPFSSSTNKEKKKQKNFMMMRYSQNVRSKNKRSFREKQLAL
  RDALLKKRKRMK

• Structural information:
  • Interpro: IPR016024  IPR027312  IPR007949  IPR012977  
  • STRING: ENSP00000348596
• Other Databases: GeneCards:  SDAD1  Malacards:  SDAD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0042273	ribosomal large subunit biogenesis	IEA	biological process
GO:0000055	ribosomal large subunit export from nucleus	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0042273	ribosomal large subunit biogenesis	ISS	biological process

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Allergic rhinitis	KEGG:H01360
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq