• Gene id: 55152

Gene Summary

• Gene Symbol: DALRD3   Gene   UCSC   Ensembl
• Gene name: DALR anticodon binding domain containing 3
• Alternate names: DALR anticodon-binding domain-containing protein 3,
• Gene location: 3p21.31 (49021250: 49015398)     Exons: 13     NC_000003.12
• Gene summary(Entrez): The exact function of this gene is not known. It encodes a protein with a DALR anticodon binding domain similar to that of class Ia aminoacyl tRNA synthetases. This gene is located in a cluster of genes (with a complex sense-anti-sense genome architecture

Protein Summary

• Protein general information: Q5D0E6  
  • Name: DALR anticodon binding domain containing protein 3
  • Length: 543  
  • Mass: 59363
• Sequence:

  MATRRLGVGETLGALNAALGPGGPVWIKETRTRHLRSRDFLAPHRALQARFDDGQVPEHLLHALACLQGPGVAPV
  LRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPASLGQRVLLHCPALRSSPCALRLSQLRTVLVADHLARAL
  RAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSHALEELTSANDGRTLSPGILGRLCLKELVEEQ
  GRTAGYDPNLDNCLVTEDLLSVLAELQEALWHWPEDSHPGLAGASDTGTGGCLVVHVVSCEEEFQQQKLDLLWQK
  LVDKAPLRQKHLICGPVKVAGAPGTLMTAPEYYEFRHTQVCKASALKHGGDLAQDPAWTEIFGVLSVATIKFEML
  STAPQSQLFLALADSSISTKGTKSGTFVMYNCARLATLFESYKCSMEQGLYPTFPPVSSLDFSLLHDEGEWLLLF
  NSILPFPDLLSRTAVLDCTAPGLHIAVRTEMICKFLVQLSMDFSSYYNRVHILGEPRPHLFGQMFVRLQLLRAVR
  EVLHTGLAMLGLPPLSHI

• Structural information:
  • Interpro: IPR008909  IPR037380  IPR009080  
  • STRING: ENSP00000344989
• Other Databases: GeneCards:  DALRD3  Malacards:  DALRD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0004814	arginine-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006420	arginyl-tRNA aminoacylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray