• Gene id: 55118

Gene Summary

• Gene Symbol: CRTAC1   Gene   UCSC   Ensembl
• Aliases: ASPIC, ASPIC1, CEP-68, CEP68, LOTUS
• Gene name: cartilage acidic protein 1
• Alternate names: cartilage acidic protein 1, acidic secreted protein in cartilage, chondrocyte expressed protein 68 kDa CEP-68,
• Gene location: 10q24.2 (98030827: 97854710)     Exons: 19     NC_000010.11
• Gene summary(Entrez): This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in cultur
• OMIM: 606276

Protein Summary

• Protein general information: Q9NQ79  
  • Name: Cartilage acidic protein 1 (68 kDa chondrocyte expressed protein) (CEP 68) (ASPIC)
  • Length: 661  
  • Mass: 71421
  • Tissue specificity: Expressed in the interterritorial matrix of articular deep zone cartilage (at protein level). Isoform 1 and isoform 2 are expressed in brain. Isoform 1 is detected in lung and chondrocytes. Detected in cartilage, bone, cultured chondro
• Sequence:

  MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAG
  YNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFSGVATYTDKLF
  KFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILAL
  RDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADF
  NRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANR
  LFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVP
  RTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSV
  LEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNE
  DGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC

• Structural information:
  • Protein Domains: (559..60-)
    (/note="EGF-like"-)
  • Interpro: IPR027039  IPR001881  IPR018097  IPR011519  
  • Prosite: PS01187
  • STRING: ENSP00000359629
• Other Databases: GeneCards:  CRTAC1  Malacards:  CRTAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021772	olfactory bulb development	IEA	biological process
GO:1900121	negative regulation of receptor binding	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0007413	axonal fasciculation	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq