• Gene id: 55101

Gene Summary

• Gene Symbol: DMAC2   Gene   UCSC   Ensembl
• Aliases: ATP5SL
• Gene name: distal membrane arm assembly complex 2
• Alternate names: distal membrane-arm assembly complex protein 2, ATP synthase subunit s-like protein, ATP5S like,
• Gene location: 19q13.2 (41447821: 41431317)     Exons: 3     NC_000019.10
• OMIM: 617262

Protein Summary

• Protein general information: Q9NW81  
  • Name: Distal membrane arm assembly complex protein 2 (ATP synthase subunit s like protein)
  • Length: 257  
  • Mass: 29267
• Sequence:

  MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRSYT
  WLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRLKEL
  QSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEM
  LPNCEVVGVDWAEGLKSGPEEQPRDTASPVPA

• Structural information:
  • Interpro: IPR026063  IPR032675  
  • STRING: ENSP00000403910
• Other Databases: GeneCards:  DMAC2  Malacards:  DMAC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005747	mitochondrial respiratory chain complex I	IBA	colocalizes with
GO:0032981	mitochondrial respiratory chain complex I assembly	IBA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0005747	mitochondrial respiratory chain complex I	IDA	colocalizes with
GO:0032981	mitochondrial respiratory chain complex I assembly	IMP	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)