• Gene id: 55095

Gene Summary

• Gene Symbol: SAMD4B   Gene   UCSC   Ensembl
• Aliases: SMGB, Smaug2
• Gene name: sterile alpha motif domain containing 4B
• Alternate names: protein Smaug homolog 2, SAM domain-containing protein 4B, smaug 2, smaug homolog B, sterile alpha motif domain-containing protein 4B,
• Gene location: 19q13.2 (39342458: 39390747)     Exons: 18     NC_000019.10
• OMIM: 610083

Protein Summary

• Protein general information: Q5PRF9  
  • Name: Protein Smaug homolog 2 (Smaug 2) (hSmaug2) (Sterile alpha motif domain containing protein 4B) (SAM domain containing protein 4B)
  • Length: 694  
  • Mass: 75483
  • Tissue specificity: Widely expressed in embryonic and adult tissues. {ECO
• Sequence:

  MMFRDQVGILAGWFKGWNECEQTVALLSLLKRVTRTQARFLQLCLEHSLADCNDIHLLESEANSAAIVSQWQQES
  KEKVVSLLLSHLPLLQPGNTEAKSEYMRLLQKVLAYSIESNAFIEESRQLLSYALIHPATTLEDRNALALWLSHL
  EERLASGFRSRPEPSYHSRQGSDEWGGPAELGPGEAGPGWQDKPPRENGHVPFHPSSSVPPAINSIGSNANTGLP
  CQIHPSPLKRSMSLIPTSPQVPGEWPSPEELGARAAFTTPDHAPLSPQSSVASSGSEQTEEQGSSRNTFQEDGSG
  MKDVPSWLKSLRLHKYAALFSQMSYEEMMTLTEQHLESQNVTKGARHKIALSIQKLRERQSVLKSLEKDVLEGGN
  LRNALQELQQIIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPP
  PAPAPTDGSEPAPAPVADGDIPSQFTRVMGKVCTQLLVSRPDEENITSYLQLIEKCLTHEAFTETQKKRLLSWKQ
  QVLKLLRTFPRKAALEMQNYRQQKGWAFGSNSLPIAGSVGMGVARRTQRQFPMPPRALPPGRMGLLSPSGIGGVS
  PRHALTSPSLGGQGRQNLWFANPGGSNSMPSQSRSSVQRTHSLPVHSSPQAILMFPPDCPVPGPDLEINPTLESL
  CLSMTEHALGDGTDKTSTI

• Structural information:
  • Protein Domains: (299..37-)
    (/note="SAM"-)
  • Interpro: IPR001660  IPR013761  IPR037634  
  • CDD: cd09557
  • STRING: ENSP00000317224
• Other Databases: GeneCards:  SAMD4B  Malacards:  SAMD4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0017148	negative regulation of translation	IBA	biological process
GO:0030371	translation repressor activity	IBA	molecular function
GO:0043488	regulation of mRNA stability	IBA	biological process
GO:0017148	negative regulation of translation	IEA	biological process
GO:0030371	translation repressor activity	IEA	molecular function
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq