• Gene id: 5509

Gene Summary

• Gene Symbol: PPP1R3D   Gene   UCSC   Ensembl
• Aliases: PPP1R6
• Gene name: protein phosphatase 1 regulatory subunit 3D
• Alternate names: protein phosphatase 1 regulatory subunit 3D, PP1 subunit R6, protein phosphatase 1 regulatory subunit 6, protein phosphatase 1, regulatory (inhibitor) subunit 3D, protein phosphatase 1, regulatory subunit 6, spinophilin, protein phosphatase 1-binding subunit R,
• Gene location: 20q13.33 (122931639: 123104868)     Exons: 32     NC_000009.12
• Gene summary(Entrez): Phosphorylation of serine and threonine residues in proteins is a crucial step in the regulation of many cellular functions ranging from hormonal regulation to cell division and even short-term memory. The level of phosphorylation is controlled by the opp
• OMIM: 603326

Protein Summary

• Protein general information: O95685  
  • Name: Protein phosphatase 1 regulatory subunit 3D (Protein phosphatase 1 regulatory subunit 6) (PP1 subunit R6) (Protein phosphatase 1 binding subunit R6)
  • Length: 299  
  • Mass: 32559
  • Tissue specificity: Expressed in all tissues tested. High expression in skeletal muscle and heart.
• Sequence:

  MSRGPSSAVLPSALGSRKLGPRSLSCLSDLDGGVALEPRACRPPGSPGRAPPPTPAPSGCDPRLRPIILRRARSL
  PSSPERRQKAAGAPGAACRPGCSQKLRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEF
  TLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDLGISGTVRVCNVAFEKQVAVRYTFSGWRSTHEAVARWRG
  PAGPEGTEDVFTFGFPVPPFLLELGSRVHFAVRYQVAGAEYWDNNDHRDYSLTCRNHALHMPRGECEESWIHFI

• Structural information:
  • Protein Domains: (169..27-)
    (/note="CBM21-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00491"-)
  • Interpro: IPR005036  IPR038175  IPR017434  
  • Prosite: PS51159
  • STRING: ENSP00000360035
• Other Databases: GeneCards:  PPP1R3D  Malacards:  PPP1R3D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000164	protein phosphatase type 1 complex	IBA	cellular component
GO:0005979	regulation of glycogen biosynthetic process	IBA	biological process
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:2001069	glycogen binding	IBA	molecular function
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0042587	glycogen granule	IEA	cellular component
GO:0005979	regulation of glycogen biosynthetic process	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0005981	regulation of glycogen catabolic process	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway
hsa04931	Insulin resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq