• Gene id: 55089

Gene Summary

• Gene Symbol: SLC38A4   Gene   UCSC   Ensembl
• Aliases: ATA3, NAT3, PAAT, SNAT4
• Gene name: solute carrier family 38 member 4
• Alternate names: sodium-coupled neutral amino acid transporter 4, N amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 4, amino acid transporter A3, amino acid transporter system A3, system A amino acid transporter 3, system N amino acid transporter 3,
• Gene location: 12q13.11 (46832421: 46764760)     Exons: 11     NC_000012.12
• Gene summary(Entrez): SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent (Hatanaka et a
• OMIM: 608065

Protein Summary

• Protein general information: Q969I6  
  • Name: Sodium coupled neutral amino acid transporter 4 (Amino acid transporter A3) (Na(+) coupled neutral amino acid transporter 4) (Solute carrier family 38 member 4) (System A amino acid transporter 3) (System N amino acid transporter 3)
  • Length: 547  
  • Mass: 60764
  • Tissue specificity: Detected in embryonic and adult liver, and at lower levels in adult muscle, kidney and pancreas. Detected in placenta syncytiotrophoblasts throughout gestation. Detected in fetal blood vessels. {ECO
• Sequence:

  MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEHHPGTT
  SFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLAVAILSLYSVHLLLKTAKEGGSLIYEKLGEKAFGWPG
  KIGAFVSITMQNIGAMSSYLFIIKYELPEVIRAFMGLEENTGEWYLNGNYLIIFVSVGIILPLSLLKNLGYLGYT
  SGFSLTCMVFFVSVVIYKKFQIPCPLPVLDHSVGNLSFNNTLPMHVVMLPNNSESSDVNFMMDYTHRNPAGLDEN
  QAKGSLHDSGVEYEAHSDDKCEPKYFVFNSRTAYAIPILVFAFVCHPEVLPIYSELKDRSRRKMQTVSNISITGM
  LVMYLLAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIVLFPIRTSVITLLFPKRPFSW
  IRHFLIAAVLIALNNVLVILVPTIKYIFGFIGASSATMLIFILPAVFYLKLVKKETFRSPQKVGALIFLVVGIFF
  MIGSMALIIIDWIYDPPNSKHH

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000389843
• Other Databases: GeneCards:  SLC38A4  Malacards:  SLC38A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015171	amino acid transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)