• Gene id: 55082

Gene Summary

• Gene Symbol: ARGLU1   Gene   UCSC   Ensembl
• Gene name: arginine and glutamate rich 1
• Alternate names: arginine and glutamate-rich protein 1,
• Gene location: 13q33.3 (106568163: 106541672)     Exons: 4     NC_000013.11
• OMIM: 614046

Protein Summary

• Protein general information: Q9NWB6  
  • Name: Arginine and glutamate rich protein 1
  • Length: 273  
  • Mass: 33216
• Sequence:

  MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRERDRERA
  SSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRK
  DEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLR
  IVEEQRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD

• Structural information:
  • Interpro: IPR033371  
  • STRING: ENSP00000383059
• Other Databases: GeneCards:  ARGLU1  Malacards:  ARGLU1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)