• Gene id: 55074

Gene Summary

• Gene Symbol: OXR1   Gene   UCSC   Ensembl
• Aliases: CHEGDD, Nbla00307, TLDC3
• Gene name: oxidation resistance 1
• Alternate names: oxidation resistance protein 1, TBC/LysM-associated domain containing 3, putative protein product of Nbla00307,
• Gene location: 8q23.1 (106270177: 106752693)     Exons: 24     NC_000008.11
• OMIM: 605609

Protein Summary

• Protein general information: Q8N573  
  • Name: Oxidation resistance protein 1
  • Length: 874  
  • Mass: 97970
• Sequence:

  MTKDKNSPGLKKKSQSVDINAPGFNPLAGAGKQTPQASKPPAPKTPIIEEEQNNAANTQKHPSRRSELKRFYTID
  TGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVSS
  VESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSG
  KGTVSGVLLVTPNNIMFDPHKNDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCH
  SKKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQDKSSGASSESVQTVN
  QAEVESLTVKSESTGTPGHLRSDTEHSTNEVGTLCHKTDLNNLEMAIKEDQIADNFQGISGPKEDSTSIKGNSDQ
  DSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGKEQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQV
  SQKEAKHKITSADGHIESSALLKEKQRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERT
  DHLYAFFIQWSPEIYAEDTGEYTREPGFIVVKKIEESETIEDSSNQAAAREWEVVSVAEYHRRIDALNTEELRTL
  CRRLQITTREDINSKQVATVKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLK
  TLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLA
  FGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE

• Structural information:
  • Protein Domains: (99..14-)
    (/note="LysM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01118-)
    (208..27-)
    (/note="GRAM-)
    (713..87-)
    (/note="TLDc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01234"-)
  • Interpro: IPR018392  IPR036779  IPR006571  
  • Prosite: PS51782 PS51886
  • CDD: cd00118
  • STRING: ENSP00000405424
• Other Databases: GeneCards:  OXR1  Malacards:  OXR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:1903204	negative regulation of oxidative stress-induced neuron death	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006979	response to oxidative stress	IBA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:0071447	cellular response to hydroperoxide	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:1902083	negative regulation of peptidyl-cysteine S-nitrosylation	IEA	biological process
GO:1900408	negative regulation of cellular response to oxidative stress	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0007628	adult walking behavior	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006979	response to oxidative stress	NAS	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq