Male Infertility Database

Search Result

Gene id

55071

Gene Summary Protein Summary Diseases PubMed

Gene Summary

Gene Symbol

C9orf40 Gene UCSC Ensembl

Gene name

chromosome 9 open reading frame 40

Alternate names

uncharacterized protein C9orf40,

Gene location

9q21.13 (60479141: 60419608) Exons: 20 NC_000015.10

Protein Summary

Protein general information

Q8IXQ3

Name: Uncharacterized protein C9orf40

Length: 194 Mass: 21063

Sequence

MAKRRAAEPVTFHVPWKRLLLCDFAEQPPPPPLWIRPPGVAHAGQLLGVPEQHRKRKIDAGTMAEPSASPSKRRD
SGDNSAPSGQEREDHGLETGDPPLPPPPVLPGPGEELPGARLPGGGGDDGAGRAGPPRGDWGVASRQHNEEFWQY
NTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDMES

Structural information

Interpro:	IPR042349 IPR033461
STRING:	ENSP00000366050

Other Databases

GeneCards: C9orf40 Malacards: C9orf40

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All