• Gene id: 54996

Gene Summary

• Gene Symbol: MTARC2   Gene   UCSC   Ensembl
• Aliases: MARC2, MOSC2
• Gene name: mitochondrial amidoxime reducing component 2
• Alternate names: mitochondrial amidoxime reducing component 2, MOCO sulphurase C-terminal domain containing 2, MOSC domain-containing protein 2, mitochondrial, moco sulfurase C-terminal domain-containing protein 2, molybdenum cofactor sulfurase C-terminal domain-containing pr,
• Gene location: 1q41 (220747416: 220784814)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is an enzyme found in the outer mitochondrial membrane that reduces N-hydroxylated substrates. The encoded protein uses molybdenum as a cofactor and cytochrome b5 type B and NADH cytochrome b5 reductase as accessory protei
• OMIM: 614127

Protein Summary

• Protein general information: Q969Z3  
  • Name: Mitochondrial amidoxime reducing component 2 (mARC2) (EC 1.7. . ) (Molybdenum cofactor sulfurase C terminal domain containing protein 2) (MOSC domain containing protein 2) (Moco sulfurase C terminal domain containing protein 2)
  • Length: 335  
  • Mass: 38023
• Sequence:

  MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKLWIYPVKSCKGVPVSE
  AECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRI
  FGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNT
  RMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCD
  PSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV

• Structural information:
  • Protein Domains: (188..33-)
    (/note="MOSC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00670"-)
  • Interpro: IPR005302  IPR005303  IPR011037  
  • Prosite: PS51340
  • STRING: ENSP00000355880
• Other Databases: GeneCards:  MTARC2  Malacards:  MTARC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0008940	nitrate reductase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0043546	molybdopterin cofactor binding	IDA	molecular function
GO:0042126	nitrate metabolic process	IDA	biological process
GO:0030151	molybdenum ion binding	IDA	molecular function
GO:0005739	mitochondrion	ISS	cellular component
GO:0051410	detoxification of nitrogen compound	NAS	biological process
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0043546	molybdopterin cofactor binding	IBA	molecular function
GO:0042126	nitrate metabolic process	IBA	biological process
GO:0030151	molybdenum ion binding	IBA	molecular function
GO:0008940	nitrate reductase activity	IBA	molecular function
GO:0030151	molybdenum ion binding	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)