• Gene id: 54936

Gene Summary

• Gene Symbol: ADPRS   Gene   UCSC   Ensembl
• Aliases: ADPRHL2, ARH3, CONDSIAS
• Gene name: ADP-ribosylserine hydrolase
• Alternate names: ADP-ribose glycohydrolase ARH3, ADP-ribosylarginine hydrolase like 2, ADP-ribosylhydrolase 3, ADP-ribosylhydrolase like 2, O-acetyl-ADP-ribose deacetylase ARH3, [Protein ADP-ribosylarginine] hydrolase-like protein 2, [Protein ADP-ribosylserine] hydrolase, poly(A,
• Gene location: 1p34.3 (36088884: 36093931)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasm.[provided by RefS
• OMIM: 603735

Protein Summary

• Protein general information: Q9NX46  
  • Name: ADP ribose glycohydrolase ARH3 (ADP ribosylhydrolase 3) (O acetyl ADP ribose deacetylase ARH3) (EC 3.5.1. ) (Poly(ADP ribose) glycohydrolase ARH3) (EC 3.2.1.143) ([Protein ADP ribosylarginine] hydrolase like protein 2) ([Protein ADP ribosylserine] hydrola
  • Length: 363  
  • Mass: 38947
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYY
  TDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVVTVFKKLLNPKCRDVFEPARAQFNGKGSYG
  NGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSEHFLKQLLGHMEDLEGD
  AQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFNS
  LQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQSLHRVFQKS

• Structural information:
  • Interpro: IPR005502  IPR036705  
  • PDB: 2FOZ 2FP0 2G4K 5ZQY 6D36 6D3A
  • PDBsum: 2FOZ 2FP0 2G4K 5ZQY 6D36 6D3A
  • STRING: ENSP00000362273
• Other Databases: GeneCards:  ADPRS  Malacards:  ADPRS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0090734	site of DNA damage	IDA	cellular component
GO:0140292	ADP-ribosylserine hydrolase activity	IDA	molecular function
GO:0140292	ADP-ribosylserine hydrolase activity	IDA	molecular function
GO:0004649	poly(ADP-ribose) glycohydrolase activity	IDA	molecular function
GO:0061463	O-acetyl-ADP-ribose deacetylase activity	IDA	molecular function
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0140290	peptidyl-serine ADP-deribosylation	IDA	biological process
GO:0140290	peptidyl-serine ADP-deribosylation	IDA	biological process
GO:0061463	O-acetyl-ADP-ribose deacetylase activity	IDA	molecular function
GO:0006281	DNA repair	IMP	biological process
GO:0071451	cellular response to superoxide	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004649	poly(ADP-ribose) glycohydrolase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0004649	poly(ADP-ribose) glycohydrolase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0140292	ADP-ribosylserine hydrolase activity	IEA	molecular function
GO:0071451	cellular response to superoxide	IEA	biological process
GO:0004649	poly(ADP-ribose) glycohydrolase activity	IEA	molecular function
GO:0140290	peptidyl-serine ADP-deribosylation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq