• Gene id: 54934

Gene Summary

• Gene Symbol: KANSL2   Gene   UCSC   Ensembl
• Aliases: C12orf41, NSL2
• Gene name: KAT8 regulatory NSL complex subunit 2
• Alternate names: KAT8 regulatory NSL complex subunit 2, NSL complex protein NSL2, non-specific lethal 2 homolog,
• Gene location: 12q13.11 (48171423: 48647496)     Exons: 75     NC_000007.14
• OMIM: 615488

Protein Summary

• Protein general information: Q9H9L4  
  • Name: KAT8 regulatory NSL complex subunit 2 (NSL complex protein NSL2) (Non specific lethal 2 homolog)
  • Length: 492  
  • Mass: 55042
• Sequence:

  MNRIRIHVLPTNRGRITPVPRSQEPLSCAFTHRPCSHPRLEGQEFCIKHILEDKNAPFKQCSYISTKNGKRCPNA
  APKPEKKDGVSFCAEHVRRNALALHAQMKKTNPGPVGETLLCQLSSYAKTELGSQTPESSRSEASRILDEDSWSD
  GEQEPITVDQTWRGDPDSEADSIDSDQEDPLKHAGVYTAEEVALIMREKLIRLQSLYIDQFKRLQHLLKEKKRRY
  LHNRKVEHEALGSSLLTGPEGLLAKERENLKRLKCLRRYRQRYGVEALLHRQLKERRMLATDGAAQQAHTTRSSQ
  RCLAFVDDVRCSNQSLPMTRHCLTHICQDTNQVLFKCCQGSEEVPCNKPVPVSLSEDPCCPLHFQLPPQMYKPEQ
  VLSVPDDLEAGPMDLYLSAAELQPTESLPLEFSDDLDVVGDGMQCPPSPLLFDPSLTLEDHLVKEIAEDPVDILG
  QMQMAGDGCRSQGSRNSEKASAPLSQSGLATANGKPEPTSIS

• Structural information:
  • Interpro: IPR026316  IPR025927  
  • PDB: 4CY2
  • PDBsum: 4CY2
  • STRING: ENSP00000415436
• Other Databases: GeneCards:  KANSL2  Malacards:  KANSL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043995	histone acetyltransferase activity (H4-K5 specific)	IBA	contributes to
GO:0043981	histone H4-K5 acetylation	IBA	biological process
GO:0043982	histone H4-K8 acetylation	IBA	biological process
GO:0043984	histone H4-K16 acetylation	IBA	biological process
GO:0043996	histone acetyltransferase activity (H4-K8 specific)	IBA	contributes to
GO:0044545	NSL complex	IBA	cellular component
GO:0046972	histone acetyltransferase activity (H4-K16 specific)	IBA	contributes to
GO:0043995	histone acetyltransferase activity (H4-K5 specific)	IDA	contributes to
GO:0046972	histone acetyltransferase activity (H4-K16 specific)	IDA	contributes to
GO:0043996	histone acetyltransferase activity (H4-K8 specific)	IDA	contributes to
GO:0043984	histone H4-K16 acetylation	IDA	biological process
GO:0043982	histone H4-K8 acetylation	IDA	biological process
GO:0043981	histone H4-K5 acetylation	IDA	biological process
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0000123	histone acetyltransferase complex	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)