• Gene id: 54929

Gene Summary

• Gene Symbol: TMEM161A   Gene   UCSC   Ensembl
• Aliases: AROS-29
• Gene name: transmembrane protein 161A
• Alternate names: transmembrane protein 161A, adaptive response to oxidative stress protein 29,
• Gene location: 19p13.11 (19138477: 19119168)     Exons: 13     NC_000019.10

Protein Summary

• Protein general information: Q9NX61  
  • Name: Transmembrane protein 161A (Adaptive response to oxidative stress protein 29) (AROS 29)
  • Length: 479  
  • Mass: 53602
• Sequence:

  MAVLGVQLVVTLLTATLMHRLAPHCSFARWLLCNGSLFRYKHPSEEELRALAGKPRPRGRKERWANGLSEEKPLS
  VPRDAPFQLETCPLTTVDALVLRFFLEYQWFVDFAVYSGGVYLFTEAYYYMLGPAKETNIAVFWCLLTVTFSIKM
  FLTVTRLYFSAEEGGERSVCLTFAFLFLLLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKL
  AIRVGLAVVGSVLGAFLTFPGLRLAQTHRDALTMSEDRPMLQFLLHTSFLSPLFILWLWTKPIARDFLHQPPFGE
  TRFSLLSDSAFDSGRLWLLVVLCLLRLAVTRPHLQAYLCLAKARVEQLRREAGRIEAREIQQRVVRVYCYVTVVS
  LQYLTPLILTLNCTLLLKTLGGYSWGLGPAPLLSPDPSSASAAPIGSGEDEVQQTAARIAGALGGLLTPLFLRGV
  LAYLIWWTAACQLLASLFGLYFHQHLAGS

• Structural information:
  • Interpro: IPR019395  
  • STRING: ENSP00000162044
• Other Databases: GeneCards:  TMEM161A  Malacards:  TMEM161A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0032526	response to retinoic acid	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0045739	positive regulation of DNA repair	IMP	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq