• Gene id: 54922

Gene Summary

• Gene Symbol: RASIP1   Gene   UCSC   Ensembl
• Aliases: RAIN
• Gene name: Ras interacting protein 1
• Alternate names: ras-interacting protein 1,
• Gene location: 19q13.33 (48740832: 48720584)     Exons: 13     NC_000019.10
• OMIM: 606505

Protein Summary

• Protein general information: Q5U651  
  • Name: Ras interacting protein 1 (Rain)
  • Length: 963  
  • Mass: 103457
  • Tissue specificity: Highly expressed in heart. Detected at lower levels in placenta and pancreas. {ECO
• Sequence:

  MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPLPPPPPHVELRRVGAV
  KAAGGASGSRAKRISQLFRGSGTGTTGSSGAGGPGTPGGAQRWASEKKLPELAAGVAPEPPLATRATAPPGVLKI
  FGAGLASGANYKSVLATARSTARELVAEALERYGLAGSPGGGPGESSCVDAFALCDALGRPAAAGVGSGEWRAEH
  LRVLGDSERPLLVQELWRARPGWARRFELRGREEARRLEQEAFGAADSEGTGAPSWRPQKNRSRAASGGAALASP
  GPGTGSGAPAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQIGTADPGDFDQLTQCLIQ
  APSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSPAPYVDTFLNAPDILPRHCTVRAGPEHPAMV
  RPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYKDPRTGGSGPARPPWLPARPGATPPGPGWAFSCRLCGR
  GLQERGEALAAYLDGREPVLRFRPREEEALLGEIVRAAAAGSGDLPPLGPATLLALCVQHSARELELGHLPRLLG
  RLARLIKEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPLMLWMANTTELLSFVQEKVLEMEKEADQED
  PQLCNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRPTLGV
  FQAALELTSQCELHPDLVSQTFGYLFFFSNASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIA
  TEFFRKLSMAVNLLCVPRTSLLKASWSSLRTDHPTLTPAQLHHLLSHYQLGPGRGPPAAWDPPPAEREAVDTGDI
  FESFSSHPPLILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANYRHGPPVATSP

• Structural information:
  • Protein Domains: (144..25-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (600..89-)
    (/note="Dilute-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00503"-)
  • Interpro: IPR037983  IPR002710  IPR000159  IPR008984  IPR029071  
  • Prosite: PS51126 PS50200
  • CDD: cd15472
  • PDB: 5KHO 5KHQ
  • PDBsum: 5KHO 5KHQ
  • DIP: 29457
  • STRING: ENSP00000222145
• Other Databases: GeneCards:  RASIP1  Malacards:  RASIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048754	branching morphogenesis of an epithelial tube	ISS	biological process
GO:0001570	vasculogenesis	ISS	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0043087	regulation of GTPase activity	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0005795	Golgi stack	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:1905709	negative regulation of membrane permeability	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000299	negative regulation of Rho-dependent protein serine/threonine kinase activity	IMP	biological process
GO:0005911	cell-cell junction	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0033625	positive regulation of integrin activation	IMP	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq